| Protein or peptide name: | CmpA |
| Chromosome: | subtilis str. 168 complete genome |
| Protein or peptide start site: | 527912 |
| Protein or peptide end site: | 528025 |
| ncRNA start site: | 527912 |
| ncRNA end site: | 528025 |
| Genome Browser: | NA |
| Protein or peptide sequence: | MPNWLKKQMQKAFLEKDNYQIKLLNQCWYFYRKKHCS |
| Protein or peptide length: | 37aa |
| ncRNA type: | ncRNA |
| ncRNA name: | cmpA |
| Entrez ID: | 37862802 |
| Experimental species: | Bacillus subtilis subsp. subtilis str. 168 |
| Experimental techniques: | GFP fluorescence |
| Experimental sample (cell line and/or tissue): | Bacillus subtilis |
| Description: | Here, we describe a sporulation pathway involving SpoVM and a 37-amino-acid-long protein named CmpA that is encoded by a previously un-annotated gene and is expressed under control of two sporulation-specific transcription factors (σ(E) and SpoIIID). |
| Subcellular location: | surface of the developing spore |
| Function: | CmpA localized to the surface of the developing spore and deletion of cmpA resulted in cells progressing through the sporulation programme more quickly. |
| Title of paper: | Small proteins link coat and cortex assembly during sporulation in Bacillus subtilis |
| PMID: | 22463703 |
| Year of publication: | 2012 |
